Freedomfoods Photos on Instagram

See related and similar tags

Report inappropriate content

@vickys_handcrafted_designs

It’s cold and rainy today. So it’s a perfect day to heat up some @freedomfoods rice bran flakes with @woolworths_au Lactose free milk and some strawberries and blueberries and maple syrup for extra flavour. Hope it’s sunny where ever you guys are! Enjoy your day and have a great weekend! #glutenfree #glutenfreecereal #glutenfreebreakfast #lactosefree #lactosefreemilk #lactosefreebreakfast #breakfast #breakfasttime #breakfastideas #blueberries #strawberries #fruit #fruitforbreakfast #healthy #healthybreakfast #glutenfreelifestyle #lactosefreelifestyle #woolworths #freedomfoods #vickyshandcrafteddesignsrecipes

2
@sunflowerkath

Just a little something to hold me over 'til lunch... #hungrymuch . . Thanks to @urthbox for this awesome @freedomfoods Almond & Cranberry Bar sample! Both tasty & filling! Perfect for when I'm on the go! πŸ’ƒπŸ˜„ at San Diego City College

1
@two_apothecaries

Love a #splendid box of goodies. . . Thank you Elena @splendour_box for providing an array of such beautiful products every month! Check out their IG page to see what they have on offer. . . It's also a great little gift idea too for that someone who has everything! . .

2
@lntanj

Mango Aloe Drink with a drop of peppermint Thank You God β™©πŸŒŸ ________________________________________________ *fruit/ herb* Β  #foodheals #foodremedies #foodcures #foodmiracle #nutrient #vitamin #mineral #cure #health #healthyfood #freedomfoods #eathealthyΒ  #IJfoodcures #campaign #fruit #vege #herb #love #thrive #Godissogood through His #creation #mango #aloevera #peppermint #lemon #livesunkiss #yalav_ig

0
@mealbyplants

The recipe for these amazing apple-cinnamon waffles is now up on the blog #linkinbio 🍎🍎🍎🍎🍎🍎 #wafflesarejustpancakeswithabs #veganwaffles at Copenhagen, Denmark

2
@yalav_ig

Starfruits ⭐ Pear 🍐 Thank You God β™©πŸŒŸ ________________________________________________ *fruit/ herb* Β  #foodheals #foodremedies #foodcures #foodmiracle #nutrient #vitamin #mineral #cure #health #healthyfood #freedomfoods #eathealthyΒ  #IJfoodcures #campaign #fruit #vege #herb #love #thrive #Godissogood through His #creation #starfruit #pear #peppermint #lemon #livesunkiss #yalav_ig

0
@lntanj

Starfruits ⭐ Pear 🍐 Thank You God β™©πŸŒŸ ________________________________________________ *fruit/ herb* Β  #foodheals #foodremedies #foodcures #foodmiracle #nutrient #vitamin #mineral #cure #health #healthyfood #freedomfoods #eathealthyΒ  #IJfoodcures #campaign #fruit #vege #herb #love #thrive #Godissogood through His #creation #starfruit #pear #peppermint #lemon #livesunkiss #yalav_ig

0
@lntanj

Starfruit yellow pear juice 🌟⭐🌟 1 drop of peppermint oil 3 drops of lemon oil Thanks God for healthy food, healthy heart and mind . Yay 😍😘 ________________________________________________ *fruit/ herb*   #foodheals #foodremedies #foodcures #foodmiracle #nutrient #vitamin #mineral #cure #health #healthyfood #freedomfoods #eathealthy  #IJfoodcures #campaign #fruit #vege #herb #love #thrive #Godissogood through His #creation #starfruit #pear #peppermint #lemon #livesunkiss #yalav_ig

1
@freedomfoodsus

Hey Dallas Freedom Foodies! At the end of October we are going to be at the Gluten Free and Allergen Friendly Expo and we want YOU to be there too! Tag a friend and #GFAFExpo to be eligable to win a free ticket for you and a friend!β € .β € .β € .β € .β € .β € .β € .β € .β € .β € .β € .β € #freedomfoods #allergenfree #healthy #happy #glutenfree #dairyfree #vegan #smoothie #yummy #instafood #eeeeeats #delicious #love #instagood #wholefoods #cleaneats #treats #instafood #yum #nom #goodeats #breakfast

6
@live_sunkiss

Thanks God for healthy food, healthy heart and mind . Yay 😍😘 Blackberry Cantaloupe kale juice ________________________________________________ *fruit/ herb*   #foodheals #foodremedies #foodcures #foodmiracle #nutrient #vitamin #mineral #cure #health #healthyfood #freedomfoods #eathealthy  #IJfoodcures #campaign #fruit #vege #herb #love #thrive #Godissogood through His #creation #cantaloupe #blackberry #helichrysum #lemon #livesunkiss #yalav_ig

0
@mealbyplants

Wise Wednesday πŸ˜‡ You'll never regret eating healthy cause it'll make you feel freaking amazing πŸ’ͺAnd you deserve to feel amazing πŸ’š #itsnotadietitsalifestyle #healthyquotes #eattherainbow #veganquotes at Copenhagen, Denmark

4
@lntanj

Thanks God for healthy food, healthy heart and mind . Yay 😍😘 Blackberry Cantaloupe kale juice ________________________________________________ *fruit/ herb*   #foodheals #foodremedies #foodcures #foodmiracle #nutrient #vitamin #mineral #cure #health #healthyfood #freedomfoods #eathealthy  #IJfoodcures #campaign #fruit #vege #herb #love #thrive #Godissogood through His #creation #cantaloupe #blackberry #helichrysum #lemon #livesunkiss #yalav_ig

0
@glutenfreebymaddie

β€’ SMOOTHIE BOWL β€’ Ingredients: Frozen mixed berries Frozen mango Frozen pineapple Flaxseeds (linseeds) @purecocobella Coconut water @freedomfoods Crafted Blends Clusters (pear, almond & vanilla flavor) @pacificorganics Coconut flakes Mixed seeds (sunflower, pumpkin, chia) Dried goji berries & sultanas Fresh strawberries & blueberries πŸ“πŸ“πŸ“πŸ“πŸ“πŸ“

5
@mealbyplants

#drooling πŸ”πŸŸ Burger with grilled tofu, red onion, tomato relish, grilled zucchini, cherry tomatoes and arugula πŸ˜πŸ‘Œ #veganburger #plantbasedburger #earlyfriday at Copenhagen, Denmark

2
@freedomfoodsus

Here’s some prebiotic breakfast Barley+ cups! Check out our Instagram story to learn how to make these tasty morning treats!β € .β € .β € .β € .β € .β € .β € .β € .β € .β € .β € #freedomfoods #BarleyPlus #guthealth #fiber #healthy #happy #delicious #love #fiberone #reboot #positive #prebiotic #healthy #happy #regram #smoothie #activebalance #yummy #dietaryfiber #instagood #wholefoods #cleaneats #treats #instafood #yum #nom #goodeats #breakfast #superfood

2
@thehealingroot_

After a beautiful class this morning, with a beautiful view over the valley and of course many more heart opener asanas I came home famished and decided to make a nourishing bowl of goodness (which ended up with me having two bowls πŸ˜‚) with the most fab Carob Walnut Granola that I made last night πŸ™ the smoothie is made with: banana, dates, almond butter, carob, pineapple, @wazoogles vanilla sky superfood mix, ice and BLEND. Topped with toasted dates and raisins which go so chewy in the icy smoothie ✨ magic in my belly for real. recipe for the granola coming soon! #govegan #healthybreakfast #healthychoices #fruit #fruitlife #whatveganseat #yogadaily #yogajourney #yogainspiration #yogateacher #freedomfoods #abundance #cleaneating #feedfeed #letscookvegan #ahealthynut #healthycuisines #bestofvegan #lawofattraction @bestofvegan #eattherainbow #pasta #greens #eatyourgreens #avocado #vegangirl #mygreenbody #kale at Rhodes University

6
@better_than_bread

Trying out the new muesli from @freedomfoods 😍 high in fibre and no nasties in the ingredients ❀️ tastes amazing too ! #FreedomFoods

2
@thehealingroot_

A delicious feast for lunch today: whole grain brown rice, served with heaps of freshly blanched veggies (carrots, cabbage, broccoli, tomato and fresh spinach) with avocado, dried olives and seed crackersβœ¨πŸ™ all about those healthy plant fats πŸ™Œ πŸ₯‘ #govegan #healthybreakfast #healthychoices #fruit #fruitlife #whatveganseat #yogadaily #yogajourney #yogainspiration #yogateacher #freedomfoods #abundance #cleaneating #feedfeed #letscookvegan #ahealthynut #healthycuisines #bestofvegan #lawofattraction @bestofvegan #eattherainbow #pasta #greens #eatyourgreens #avocado #vegangirl #mygreenbody #kale

5
@thehealingroot_

Friends are for lying in fields of green pondering the big life questions and honestly, there is no friend I’d rather do that with right now than you my darling fairy angel friend @rosannahepburn πŸ™βœ¨ thank you for the being the light that you are πŸŒ™ I love you always. This magnificent women just spent a week cooking completely vegetarian meals for a completely carnivorous family in Spain and they LOVED it. Not to mention that the father of the family completed an Iron Man powered by PLANTS and said he felt fantastic ✊️❀️ #yoga #yogafood #yogaeverydamnday #vegan #veganism #veganlife #veganfitness #breakfast #vegannoms #rt4 #801010 #lowfat #juicing #plantpower #plantbased #fitness #cleaneats #fitspo #nutrition #nutrients #health #weightloss #highcarb #hclfv #wholefoods #avocado #hflc #glutenfree #paleo #rawvegan at Grahamstown, Eastern Cape

4
@freedomfoodsus

Take a look at this protein packed prebiotic snack bowl from our 28 Day Reboot participant @kimhoeltje ! . . . . . . . . . . . . #freedomfoods #barleyplus #allergenfree #healthy #happy #glutenfree #dairyfree #vegan #smoothie #yummy #instafood #eeeeeats #delicious #love #instagood #wholefoods #cleaneats #treats #instafood #yum #nom #goodeats #breakfast

2
@inlakeshlivingfoods

Making healthy snacks got a whole lot easier with #FreedomFoods' range of Active Balance cereals! Plus, it's also free from gluten, wheat & nuts. Try these apples topped with yogurt, fruits and Active Balance multigrain & cranberry cereal! πŸπŸ“πŸ‡ Shop our range of Active Balance cereals at #Inlakesh: http://bit.ly/2xH85mN

1
@thehealingroot_

Guys. Can we just 😍 this avo was the cutest thing I’ve just about ever eaten, the creamiest and most delicious avo too (besides the garden avos) πŸ₯‘ delightful things come in small packages: never underestimate the power of the almighty AVOCADO. Even if it is the size of half of your palm πŸ˜‚ #govegan #healthybreakfast #healthychoices #fruit #fruitlife #whatveganseat #yogadaily #yogajourney #yogainspiration #yogateacher #freedomfoods #abundance #cleaneating #feedfeed #letscookvegan #ahealthynut #healthycuisines #bestofvegan #lawofattraction @bestofvegan #eattherainbow #pasta #greens #eatyourgreens #avocado #vegangirl #mygreenbody #kale at Rhodes University

7
@mealbyplants

APPLE-CINNAMON WAFFLES 🍎😍🍏 #wafflesarejustpancakeswithabs #boringveganfood #appleseason Recipe coming soon #staytuned #applecinnamon #autumn #veganwaffles at Copenhagen, Denmark

6
@glutenfreeformeandyou_

Such a perfect study snack πŸ“š @freedomfoods new QUINOA chips! Our favourite flavour is salt and vinegar πŸ’œ We got them in our goodie bags at @glutenfreeexpoau and have been addicted ever since!

5
@bellwest

Cinnamon proats with a hit of Vit-C 🍍πŸ₯πŸ’› #justeatrealfood

4
@freedomfoodsus

Here at Freedom Foods we work hard each day to make sure you have the best β€œfree from” foods available!β € .β € .β € .β € .β € .β € .β € .β € .β € .β € #freedomfoods #allergenfree #healthy #happy #glutenfree #dairyfree #vegan #smoothie #yummy #instafood #eeeeeats #delicious #love #instagood #wholefoods #cleaneats #treats #instafood #yum #nom #goodeats #breakfast

1
@healthy_liline

Special New zealand week in my supermarket πŸ”±β­ love itπŸƒπŸπŸ€πŸŒ½ Lot of products from the country 😍 It was like im on holidays πŸ˜‚πŸ‘œπŸ’² #popcorn #newzealandπŸ‡³πŸ‡Ώ #newzealand #newzealandproduct #coconutyogurt #nogluten #glutenfree #soyfree #organicfood #organic #biologique #bio #chocolate #muesli #ceresorganics #freedomfoods #cathedralcove #rockyroad #loaf #instafood #instaorganic #instaeat

1
@mealbyplants

WOK IS UP? πŸ˜‚ #imsofunny Wok is definitely one of my go to dishes when I want something quick, easy and delicious πŸ€— #vegandinner And you can make so many different variations #winwin What is your go to dish? at Copenhagen, Denmark

2
@lntanj

Yay thanks God fruits platter after dinner 😘❀😍 _________________________________________________ *fruit/ herb*   #foodheals #foodremedies #foodcures #foodmiracle #nutrient #vitamin #mineral #cure #health #healthyfood #freedomfoods #eathealthy  #IJfoodcures #campaign #fruit #vege #herb #love #thrive #Godissogood through His #creation #cantaloupe #mango #pear #reddragon #livesunkiss #yalav_ig

3
@nadis_culinary_journey

Uzbek Soup - Mastava 🍲!!! When fall is already here and winter is approaching, piping hot soup is must for dinner. This Rice and meat soup is tasty, nutritious and filling, makes a whole meal by its own!! They are absolutely comforting too ☺️ Recipe up on the blog........link in profile πŸ‘† #soup #mastava #uzbeksoup #riceandmeatsoup #pipinghot #confortingfood #tastysoup #easyrecipe #winterspecialrecipe #fallrecipe #instafood #buzzfeed #buzzfeedfood #buzzfeastfood #instagramer #foodfood #food52 #food52gram #huffposttaste #foodblog #freedomfoods #tastespotting #tastemade #bbcgoodfood #foodfrique #healthyrecipe #glutenfree

2
@mealbyplants

Could so go for these chocolate waffles right now πŸ«πŸ’ #wafflesarejustpancakeswithabs These are by far the best waffles I've ever had 😍 #veganwaffles #glutenfree I have to get them again real soon!! at Acacia KΓΈbenhavn

4
@live_sunkiss

Yellow Kiwi Kale Juice yum πŸ˜—β€πŸ˜ thank You God 1 drop of Helichrysum 1 tbl spoon cumin honey Splash of olive oil Yakult _________________________________________________ *fruit/ herb* Β  #foodheals #foodremedies #foodcures #foodmiracle #nutrient #vitamin #mineral #cure #health #healthyfood #freedomfoods #eathealthyΒ  #IJfoodcures #campaign #fruit #vege #herb #love #thrive #Godissogood through His #creation #yellowkiwi #helichrysum #kale #livesunkiss #yalav_ig

0
@deidre_plus4

Of course the one time I forget to put the cereal away this little guy notices and helps himself πŸ™„ This little monkey πŸ’is too cute to be mad at though 😊He LOVES these XO Crunch Cocoa Puffs from Freedom Foods. This why we only have allergy friendly foods in our house - you never know what they will get their hands on when they are still too young to understand their allergies #cheekymonkey #mumlife #mumofboys #kidswithallergies #allergyaware #peanutallergy πŸ₯œ #eggallergy πŸ₯š #freedomfoods @globalaai @freedomfoods

1
@lntanj

Yellow Kiwi Kale Juice yum πŸ˜—β€πŸ˜ thank You God 1 drop of Helichrysum 1 tbl spoon cumin honey Splash of olive oil Yakult _________________________________________________ *fruit/ herb* Β  #foodheals #foodremedies #foodcures #foodmiracle #nutrient #vitamin #mineral #cure #health #healthyfood #freedomfoods #eathealthyΒ  #IJfoodcures #campaign #fruit #vege #herb #love #thrive #Godissogood through His #creation #yellowkiwi #helichrysum #kale #livesunkiss #yalav_ig

0
@wheelerseafood

When selecting the salmon for your customers, restaurant, or retail store, what are your looking for? Wester Ross Salmon uses a hands on "fish first" farming philosophy, where hand feeding them through their entire life happens. They are stronger, firmer than other fish. Raised by oldest and only independent farm in Scotland, all Scottish owned, by our close friend, first for smoking in 70s, now carried top retail, and restaurant, sushi shops around the planet. #elevatedminds #farmtotable #top50restaurantsintheworld #jamesbeard #cheflife #freedomfoods #montereybayaquarium #starchefs #platingfood #local130seafood #brownetrading #paganosseafood #fabulousfish #trinityseafood #oraking

2
@studio_on_sunshine

I have a new friend #freedomfoods #freedomfoodscraftedblendclusters #craftedblendsclusters i have NOT been kind to my body at all lately!!! Ive been eating so much gluten and its been a painful way to live. My 2 younger brothers are "coeliac" and im "gluten intolerant" .... ive heard MANY people go on about people that eat gluten free (GF).... many people say its a fad etc... well Ive had medical tests and have been diagnosed by medical drs.... for people like my brothers and I.... its a way WE NEED TO EAT.. so bare with me in sharing a GREAT PRODUCT when I find a lovely tasting GF product! I have this each morning with fresh blueberries...... my belly and bowels LOVE ME for starting the day right... TAKE CARE OF YOURSELF AND YOU WILL FEEL BETTER..YOU DESERVE TO FEEL BETTER 😚 #loveyourbody #takecareofyourself

1
@mealbyplants

Wise Wednesday πŸ˜‡πŸ‘πŸŽŽ #wisewords Health (and beauty) starts within πŸ’– #quotes #beyourself at Copenhagen, Denmark

2
@thehealingroot_

OH yes oh yes oh yes πŸ™ my benchmark for Summer having arrived is: WATERMELON ARRIVAL πŸ‰ πŸ™Œ so incredibly grateful for this delicious, juicy and SWEET fruit today. The joy in my being literally jolted me when I saw it sitting unassumingly on the shop shelf! Happy Summer everyone πŸ–– #yoga #yogafood #yogaeverydamnday #vegan #veganism #veganlife #veganfitness #breakfast #vegannoms #rt4 #801010 #lowfat #juicing #plantpower #plantbased #fitness #cleaneats #fitspo #nutrition #nutrients #health #weightloss #highcarb #hclfv #wholefoods #hflc #glutenfree #paleo #rawvegan #watermelon

11
@lntanj

Peach Tea Yay thanks God #smells #really #good #yumm #nosugar #forme #the #sweet #aroma is #enough Its antioxidant effects coming from the presence of zinc, ascorbic acid, and vitamin C might be useful in promoting healing of wounds as well as fortifying the immune system by fighting against infections, and thus helping in managing pneumonia, common cold Its antioxidant effects coming from the presence of zinc, ascorbic acid, and vitamin C might be useful in promoting healing of wounds as well as fortifying the immune system by fighting against infections, and thus helping in managing pneumonia, common cold #freedomfoods #eathealthyΒ  #IJfoodcures #campaign #fruit #vege #herb #love #thrive #Godissogood through His #creation #peach #tea #livesunkiss #yalav_ig

0
@polkadotcommunications

The Messy Monkeys wholegrain bites from @freedomfoods are the perfect lunch box snacks for kids! πŸ“·: @bytheseawiththree #freedomfoods #messymonkeys #healthy #kidssnacks #lunchbox

1
@thebod_mummagetsfit

Afternoon tea! I have a new obession with this cereal and what better way to eat it than with a vanilla yopro and aminos πŸ‘Œ i could seriously sit there infront of the tv with the box and eat it all its that damn good! @yoproau and @freedomfoods making afternoon tea heavenly since 2017 πŸ‘ŒπŸ‘ŒπŸ‘Œ #yopro #yoprovanilla #freedomfoods #maplesyrupcereal #onnutrition #aminos #afternoontea #thebod #thebodmaintenance #bodbabes #bodmums #thebodmums #bodmums #sophieguidolin #mummagetsfit

6
@live_sunkiss

Mango strawberry juice. 1 drop of Helichrysum 1 tbl spoon cumin honey Splash of olive oil Yakult #both #sour #haha #vitC #thanksGod _________________________________________________ *fruit/ herb* Β  #foodheals #foodremedies #foodcures #foodmiracle #nutrient #vitamin #mineral #cure #health #healthyfood #freedomfoods #eathealthyΒ  #IJfoodcures #campaign #fruit #vege #herb #love #thrive #Godissogood through His #creation #strawberry # #mango #livesunkiss #yalav_ig

0
@lntanj

Mango strawberry juice. 1 drop of Helichrysum 1 tbl spoon cumin honey Splash of olive oil Yakult #both #sour #haha #vitC #thanksGod _________________________________________________ *fruit/ herb* Β  #foodheals #foodremedies #foodcures #foodmiracle #nutrient #vitamin #mineral #cure #health #healthyfood #freedomfoods #eathealthyΒ  #IJfoodcures #campaign #fruit #vege #herb #love #thrive #Godissogood through His #creation #strawberry # #mango #livesunkiss #yalav_ig

0
@emmandkelly

Brekky today 😊 @yoproau strawberry yoghurt topped with @freedomfoods clusters, banana, pepitas and i was late to work because i couldn’t possibly eat it without roasting some coconut flakes and having them on top! πŸ˜‚ #healthybreakfast #happywednesday #freedomfoods #yopro #yoghurt #banana #coconutislife #healthyeating #fitness #healthyfood

2
@freedomfoodsus

😍 β € β € Check out our story to learn how to make this tasty smoothie!β € .β € .β € .β € .β € .β € .β € .β € .β € .β € .β € #freedomfoods #BarleyPlus #guthealth #fiber #healthy #happy #delicious #love #fiberone #reboot #positive #prebiotic #healthy #happy #regram #smoothie #activebalance #yummy #dietaryfiber #instagood #wholefoods #cleaneats #treats #instafood #yum #nom #goodeats #breakfast #superfood

0
@mealbyplants

Look at this beautiful piece of salad πŸ’šπŸ’š #natureisawesome at Copenhagen, Denmark

4
@thehealingroot_

Green is the color of the heart chakra: the gateway between the lower chakras and the upper chakras πŸ™ the bridge between the manifest and he energetic. after a delicious heart opening flow class this morning, I am feeling open, relaxed, calm and receptive ✨ the power of heart opening asanas is almost tangible - since including more and more heart openers into my personal and teaching practice, I have literally felt the lightness in my heart space as I breath life into it with each inhalation. Allowing each exhalation to carry all that needs to be carried out, our. Namaste πŸ™ pictured is: grilled garlicky cauliflower with a tangy vinaigrette dressing and fresh Margoram ✨ #yoga #yogafood #yogaeverydamnday #vegan #veganism #veganlife #veganfitness #breakfast #vegannoms #rt4 #801010 #lowfat #juicing #plantpower #plantbased #fitness #cleaneats #fitspo #nutrition #nutrients #health #weightloss #highcarb #hclfv #wholefoods #avocado #hflc #glutenfree #paleo #rawvegan

7
@thehealingroot_

Throwing it back to this miso soup with sugar snap beans paired with a salad with roasted chickpeas, tofu and other veg ✨✊️ moving into week two of the Challenge - feeling really good and light and energized especially because of the increased vegetable intake βœ¨πŸ™Œ how are you guys finding it so far? What are some challenges you’ve experienced and what has surprised you?πŸ’‘ #govegan #healthybreakfast #healthychoices #fruit #fruitlife #whatveganseat #yogadaily #yogajourney #yogainspiration #yogateacher #freedomfoods #abundance #cleaneating #feedfeed #letscookvegan #ahealthynut #healthycuisines #bestofvegan #lawofattraction @bestofvegan #eattherainbow #pasta #greens #eatyourgreens #avocado #vegangirl #mygreenbody #kale at Grahamstown, Eastern Cape

6
@mealbyplants

POTATO-LEEK SOUP 🍲 Nice and warming autumn dinner πŸπŸ‚ #soupseason at Copenhagen, Denmark

2
@lntanj

Late night snack May we eat and it becomes energy 0 fat wakaka Amen P.s. what u see is not the only things I eat haha __________________________________________________ *fruit/ herb* Β  #foodheals #foodremedies #foodcures #foodmiracle #nutrient #vitamin #mineral #cure #health #healthy #healthyfood #freedomfoods #fitnessfood #eathealthyΒ  #IJfoodcures #campaign #fruit #vege #herb #love #thrive #Godissogood through His #creation #capsicum #carrot #inoki #lemon #livesunkiss #yalav_ig

3
@thehealingroot_

So NUMBER TWO (of things realized last night during my insomniac state: read spinach, chickpea & olive post for no. 1): when you resist what IS, life becomes harder, more labor intensive. Just give the resisting a damn BREAK already. Trust your presence, trust the ordinary deliciousness of your existence as it is - it is enough. Trust your space in the world in all of its ordinary delight. You are beaming light from exactly where you are - you don’t constantly have to strive for more, to be more, to grow more etc. just be where you are and allow fluidity and ease to come into your life. Release rigidity, release resistance. πŸŽ₯:. Some side salad goodness πŸ™βœ¨ or used as rice paper roll stuffing! #govegan #healthybreakfast #healthychoices #fruit #fruitlife #whatveganseat #yogadaily #yogajourney #yogainspiration #yogateacher #freedomfoods #abundance #cleaneating #feedfeed #letscookvegan #ahealthynut #healthycuisines #bestofvegan #lawofattraction @bestofvegan #eattherainbow #pasta #greens #eatyourgreens #avocado #vegangirl #mygreenbody #kale at Grahamstown, Eastern Cape

4
@thehealingroot_

Creeping on my delicious hot healing spicy cacao drink: recipe on the blog! Think cardamom, Turmeric, cinnamon, chaga, cacao and maca among other goodies like fresh ginger πŸ˜πŸ™πŸŒ™ let me know what you think of you have or do try it πŸ’‘ much love to you all today 🌱 #govegan #healthybreakfast #healthychoices #fruit #fruitlife #whatveganseat #yogadaily #yogajourney #yogainspiration #yogateacher #freedomfoods #abundance #cleaneating #feedfeed #letscookvegan #ahealthynut #healthycuisines #bestofvegan #lawofattraction @bestofvegan #eattherainbow #pasta #greens #eatyourgreens #avocado #vegangirl #mygreenbody #superfoods at Grahamstown, Eastern Cape

5
@millylovesmay

Today I went to the baths and nearly lost a Birkenstock to the sea (thanks to the lovely stranger who saved it), got an email from the lair that my package was on its way and discovered the gluten free equivalent of Nutri-grain (thanks @freedomfoods ), oh and here's a cute little harlequin bug I met... #harlequinbug #birkenstocks #childofthesea #dreamin #mood #babin #takemebacktothesea #glutenfree #freedomfoods

0
@devon.n.black

Over the course of the last month I have eaten so many cranberry and apple flavored dishes it is crazyπŸ™ˆ but not until today, TODAY did I get the idea to make apple #nicecream.😍 I know, I know, how did this happen? Well, for starters I have been constantly cold since the temperatures started hanging I'm around the 75Β° markπŸ™ˆ but today it was 84Β° πŸ‘πŸ‘πŸ‘ While we're clapping, let's give a round if applause to apple juice and bananas!πŸŽπŸŒπŸ™Œ Sure there was coconut sugar, some vanilla extract, a little almond milk, and lots of cinnamon but the star of the show was the apple juice- such a refreshing bowl! That was, anyhow, until I added the pink lady apple muesli and bar bits to the top- oh how they shined. The @freedomfoodsus goods were the sun and the nice cream- the moon, reflecting the care they took in creating such a beautiful flavor profile. I can't get over it. I threw in some extra seeds and raisins, and of course almond butter on top of the dreamy mess, et voila! πŸ˜πŸ’– . . Also over the last month I have been keeping track of my overall sense of health from ingesting a bowl of @freedomfoodsus #barleyplus muesli and a snack bar each day, and I can truly say I have seen and felt the results of getting in the proper amounts of fiber each day. I have felt my bloating go from an all the time occurrence to something I don't even think about because I'm not constantly uncomfortable. If you can't tell by my previous statements it was so easy to get into the swing of things with such tasty products. I'm thinking I'm going to keep these foods in my daily regimen for a while. I recently found a maple flavor of muesli at a local grocer so that shall be my next endeavor.πŸ‘Œ I highly recommend trying out some @freedomfoodsus products if you're feeling bloated, constipated, or just overall icky. Lots of illnesses begin in the gut so the sooner you begin eating right for it, the sooner you'll get to feeling better! PromiseπŸ™ŒπŸ’›βœ¨ . Get your own!πŸ’ Use code REBOOT25 to receive 25% of Barley+ on Amazon.com Visit barleyplus.com.au and click β€œBuy Now”. πŸ’• . . . 4 frozen bananas 1/3 cup apple juice Splash of almond milk 3 drops vanilla extract Cinnamon to your liking ------>

14
@alfonso1881

Check out the new kid on the block...@alexjuniorespresso in Padbury. They have your Alternative MilkLAB Coffee waiting for you. #milklabco #freedomfoods #alexjuniorespresso #milklab

0
@beautyandlifestylehunter

If you're looking for healthy, nutritious and tasty snacks for your little kids, then you have to try these messy monkey bites from freedom foods. The are made with Quinoa and Sorghum and have a high fibre content and they contain only natural ingredients which means absolutely no artificial colours, preservatives or flavours. And they have a health star rating of 4, so you can relax knowing that your little monkeys are not loaded with junk. For my boys, these are a huge hit! Plus the small bags are perfect for popping into the bag for when they need a snack when you're on the go. - What’s your kids preferred snack?? πŸ’•πŸ’• . . . . . #freedomfoods #messymonkeys #lunchbox #kids #snacks #kidssnacks #healthy #healthykids #lunchboxideas #happykids #food #quinoa #melbournemum #mummybloggerau #influencer #parentingblog #discoverunder10k {Gifted}

29
@thehealingroot_

EAT MORE PLANT FOODS 🌱 they are the foods that will make your body tingle with alive-ness and gratitude for simply BEING ALIVE. They are the foods that will allows your energy, conscience, consciousness and mind be lighter πŸ’‘ brighter ✨ they will allow you to breath life into your life again, instead of perpetuating the cycles of negativity, suffering and cruelty. πŸŽ₯: chickpea pancake topped with miso, hummus, roasted pumpkin, bell pepper, eggplant, glazed Brussels sprouts, butter beans and toasted seeds. Oh and AVOCADO πŸ₯‘ #govegan #healthybreakfast #healthychoices #fruit #fruitlife #whatveganseat #yogadaily #yogajourney #yogainspiration #yogateacher #freedomfoods #abundance #cleaneating #feedfeed #letscookvegan #ahealthynut #healthycuisines #bestofvegan #lawofattraction @bestofvegan #eattherainbow #pasta #greens #eatyourgreens #avocado #vegangirl #mygreenbody #kale at Grahamstown, Eastern Cape

18
@thehealingroot_

I’ve come to realize some pretty profound things tonight. I will share them in the posts to follow, delving deeper into each one. The first one tonight is as follows: 1. HEALTH, LOVE, ABUNDANCE, JOY simply IS. Naturally, by constantly grasping, reaching, longing, wanting and affirming that you want these things (insert whatever you desire), means that what you are actually affirming is a lack thereof! Just BE THESE THINGS because they simply ARE. Allow. Allow their natural β€œness” to arise by letting go of the constant wanting & striving. Just be them. Feel them. They are there, they are just needing you to embody them. For me, Yoga allows me to be these things, it allows me to simply rest in them instead of reach for them. Find what it is that allows you to connect to all that IS, and do more of it πŸŒ™ πŸŽ₯: A simple yet divine dish: garlicky sautΓ©ed spinach with chili, olives and chickpeas topped with a dash of soy sauce πŸ’ƒ Oil-free and challenge friendly ✊️ #govegan #healthybreakfast #healthychoices #fruit #fruitlife #whatveganseat #yogadaily #yogajourney #yogainspiration #yogateacher #freedomfoods #abundance #cleaneating #feedfeed #letscookvegan #ahealthynut #healthycuisines #bestofvegan #lawofattraction @bestofvegan #eattherainbow #pasta #greens #eatyourgreens #avocado #vegangirl #mygreenbody #kale at Grahamstown, Eastern Cape

12
@mealbyplants

FABULOUS FALL BREAKFAST 🍁 Overnight Oats (Bircher muesli) with butternut squash and fall spices πŸŽƒ The breakfast breakfast for the dark autumn mornings πŸ‚πŸƒπŸŒ’ #sweaterweather #recipeontheblog #linkinbio at Copenhagen, Denmark

5
@mojo_aboueid

Great day at the gluten free expo!! #freedomfoods #glutenfreeexpo

0
@thehealingroot_

Sipping on a refreshing glass of delicious Kombucha ✨ after a busy morning. Topped it with some garden mint after this pic, which took it to a whole different level of awesome. What are your favorite kombucha flavors? 🍍 #govegan #healthybreakfast #healthychoices #fruit #fruitlife #whatveganseat #yogadaily #yogajourney #yogainspiration #yogateacher #freedomfoods #abundance #cleaneating #feedfeed #letscookvegan #ahealthynut #healthycuisines #bestofvegan #lawofattraction @bestofvegan #eattherainbow #pasta #greens #eatyourgreens #avocado #vegangirl #mygreenbody #kombucha at Grahamstown, Eastern Cape

8
@mealbyplants

PUMPKIN SEASON πŸŽƒ Yesterday I made these baked hokkaido wedges 🍁 #fallfood I took one hokkaido pumpkin, removed the seeds and cut it into wedges and put them in a mixing bowl together with the juice of half a lemon, two cloves of garlic (minced), a pinch of chili powder, 1-2 tbsp. sesame seeds and salt and pepper πŸ‹πŸ½ Bake them in the ovnen at 200C/400F for 20-25 minutes βœ… WHAT IS YOUR FAVORITE PUMPKIN DISH? πŸŽƒ at Copenhagen, Denmark

3
@southernstargypsies

πŸ˜‹πŸ˜‹πŸ˜‹πŸ˜‹ Clean LCM Bars πŸ˜‹ After school snacks are done βœ… it's such a shame she can't take them to school 😭 β€’ β€’ β€’ Using our favourite cleaner version ingredients made by @mayversfood @pureharvest @freedomfoods #healthylifestyle #healthysnacks #cleaneats #lcms #healthykids #getinmybelly #cleansnack #freedomfoods #mayvers #pureharvest at Woonona Beach

1